Structure of PDB 7f75 Chain G Binding Site BS02

Receptor Information
>7f75 Chain G (length=129) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVTLYTSPSCTSCRKARAWLEEHDIPFVERNIFSEPLSIDEIKQILRMTE
DGTDEIISTRSKVFQKLNVNVESMPLQDLYRLINEHPGLLRRPIIIDEKR
LQVGYNEDEIRRFLPRKVRPFQLREAQRL
Ligand information
>7f75 Chain K (length=63) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgcatccgtgagtcgagggtaataaagcatctcccattcgttcacgctat
tttaatgcttaca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f75 Structural basis of transcription activation by the global regulator Spx.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		S12 R60 K62 R91 R92 G104 Y105 N106 E107
Binding residue
(residue number reindexed from 1)		S12 R60 K62 R91 R92 G104 Y105 N106 E107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f75, PDBe:7f75, PDBj:7f75
PDBsum7f75
PubMed34530448
UniProtO31602|SPX_BACSU Global transcriptional regulator Spx (Gene Name=spx)

[Back to BioLiP]