Structure of PDB 7eyi Chain G Binding Site BS02

Receptor Information
>7eyi Chain G (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHM
RKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSD
HLHRHLKKDGC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eyi Structural basis for human ZBTB7A action at the fetal globin promoter.
Resolution2.401 Å
Binding residue
(original residue number in PDB)
I391 Q392 K396 R399 H400 R421 K424 K431 K436 F447 R464 K473 R477 H480 R483
Binding residue
(residue number reindexed from 1)
I12 Q13 K17 R20 H21 R42 K45 K52 K57 F68 R85 K94 R98 H101 R104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7eyi, PDBe:7eyi, PDBj:7eyi
PDBsum7eyi
PubMed34592153
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]