Structure of PDB 7et4 Chain G Binding Site BS02

Receptor Information
>7et4 Chain G (length=99) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVRR
FRGRDAVTNFKSQVDGNDAESAFLDAHSKAEIVDMLRKHTYADEFEQSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7et4 TEM1 combinatorially binds to FLOWERING LOCUS T and recruits a Polycomb factor to repress the floral transition in Arabidopsis.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Q78 R82 R93 W95 T98
Binding residue
(residue number reindexed from 1)		Q13 R17 R28 W30 T33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7et4, PDBe:7et4, PDBj:7et4
PDBsum7et4
PubMed34446554
UniProtQ9C6M5|RAVL1_ARATH AP2/ERF and B3 domain-containing transcription repressor TEM1 (Gene Name=TEM1)

[Back to BioLiP]