Structure of PDB 7e8d Chain G Binding Site BS02

Receptor Information

>7e8d Chain G (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN
IQAVLLPKK

Ligand information

>7e8d Chain J (length=172) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acatgcacaggatgtatatatctgacacgtgcctggagactagggagtaa
tccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcg
gtgctagagctgtctacgaccaattgagcggcctcggcaccgggattctc
cagggcggccgcgtatagggtc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7e8d Structural basis of the regulation of the normal and oncogenic methylation of nucleosomal histone H3 Lys36 by NSD2.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	R11 R29 R42 V43 G44 A45 K75 T76 R77
Binding residue (residue number reindexed from 1)	R1 R19 R32 V33 G34 A35 K65 T66 R67

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0019899	enzyme binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0008150	biological_process
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7e8d, PDBe:7e8d, PDBj:7e8d
PDBsum	7e8d
PubMed	34782608
UniProt	P0C0S8\|H2A1_HUMAN Histone H2A type 1 (Gene Name=H2AC11)

[Back to BioLiP]