Structure of PDB 7d8o Chain G Binding Site BS02

Receptor Information
>7d8o Chain G (length=163) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKFFTISSSYIKYLKDFDDKVPNSEDPTYNNPKAFIGIVLEIEGHKYLA
PLTSPKAWHANVKESSPAFFKLHENGVPDNQLGLINLKFMIPIIEAEVSL
LDLDSMPDTPYKRMLYKQLQFIRVNEDKISEKSKLLRNLALQGRMQGTCD
FAVLEEKYQHFGK
Ligand information
>7d8o Chain L (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuuaggugauuugcuaccuuuaagugcagcuagaaa
....<<<<...((((.>>>>......)))).......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d8o Identification, functional characterization, assembly and structure of ToxIN type III toxin-antitoxin complex from E. coli.
Resolution2.097 Å
Binding residue
(original residue number in PDB)		K2 F3 Y29 N30 N31 K33 L51 T52 S53 P54 E73 N79 L81 L100 L102 D103 P109 Y110 M113 Y115 K116 Q117 L118 Q119 R122 V123
Binding residue
(residue number reindexed from 1)		K3 F4 Y30 N31 N32 K34 L52 T53 S54 P55 E74 N80 L82 L101 L103 D104 P110 Y111 M114 Y116 K117 Q118 L119 Q120 R123 V124
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 08:29:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7d8o', asym_id = 'G', bs = 'BS02', title = 'Identification, functional characterization, ass...IN type III toxin-antitoxin complex from E. coli.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7d8o', asym_id='G', bs='BS02', title='Identification, functional characterization, ass...IN type III toxin-antitoxin complex from E. coli.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0004521', uniprot = '', pdbid = '7d8o', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0004521', uniprot='', pdbid='7d8o', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>