Structure of PDB 7cvq Chain G Binding Site BS02

Receptor Information
>7cvq Chain G (length=86) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKC
QKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cvq Structural insights into the multivalent binding of the Arabidopsis FLOWERING LOCUS T promoter by the CO-NF-Y master transcription factor complex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		I51 S52 R83 K84
Binding residue
(residue number reindexed from 1)		I23 S24 R55 K56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cvq, PDBe:7cvq, PDBj:7cvq
PDBsum7cvq
PubMed33693873
UniProtQ9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 (Gene Name=NFYB2)

[Back to BioLiP]