Structure of PDB 7ad8 Chain G Binding Site BS02

Receptor Information

ICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDC
DLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEA
KEVRQENREKMKQKKFDKKVKELRRAVRSSVWKR

Ligand information

gaattcgagctcgcaacaatgagcacat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	7ad8 The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	Q174 W175 R211
Binding residue (residue number reindexed from 1)	Q71 W72 R108

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0005515	protein binding
GO:0019904	protein domain specific binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:1990837	sequence-specific double-stranded DNA binding

	Biological Process
GO:0000715	nucleotide-excision repair, DNA damage recognition
GO:0006281	DNA repair
GO:0006284	base-excision repair
GO:0006289	nucleotide-excision repair
GO:0009650	UV protection
GO:0010996	response to auditory stimulus
GO:0034504	protein localization to nucleus
GO:0070914	UV-damage excision repair
GO:1901255	nucleotide-excision repair involved in interstrand cross-link repair

	Cellular Component
GO:0000110	nucleotide-excision repair factor 1 complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005662	DNA replication factor A complex
GO:0045171	intercellular bridge

External links

PDB	RCSB:7ad8, PDBe:7ad8, PDBj:7ad8
PDBsum	7ad8
PubMed	33166411
UniProt	P23025\|XPA_HUMAN DNA repair protein complementing XP-A cells (Gene Name=XPA)