Structure of PDB 6yef Chain G Binding Site BS02

Receptor Information
>6yef Chain G (length=154) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNA
VEELELITGQKPLVTKATFRLREGMPIGAKVTLRGERMYEFLDKLISVSL
PRVRDFQGVSKKAFDGRGNYTLGVKEQDKVSKVRGMDIVIVTTANTDEEA
RELL
Ligand information
>6yef Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagu
agaacguugccaggc
<<<<<<<<<....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>.....
.>>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yef Cryo-EM structure of the ribosome functional complex of the human pathogen Staphylococcus aureus at 3.2 angstrom resolution.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
S24 M26 E27 T61 Q63 T90 R92
Binding residue
(residue number reindexed from 1)
S21 M23 E24 T58 Q60 T82 R84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6yef, PDBe:6yef, PDBj:6yef
PDBsum6yef
PubMed32852796
UniProtQ2FW18|RL5_STAA8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]