Structure of PDB 6y9p Chain G Binding Site BS02

Receptor Information
>6y9p Chain G (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGH
VILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y9p Deciphering the Unexpected Binding Capacity of the Third PDZ Domain of Whirlin to Various Cochlear Hair Cell Partners.
Resolution3.169 Å
Binding residue
(original residue number in PDB)
R881 K888
Binding residue
(residue number reindexed from 1)
R70 K77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6y9p, PDBe:6y9p, PDBj:6y9p
PDBsum6y9p
PubMed32971111
UniProtQ80VW5|WHRN_MOUSE Whirlin (Gene Name=Whrn)

[Back to BioLiP]