Structure of PDB 6wz9 Chain G Binding Site BS02

Receptor Information
>6wz9 Chain G (length=106) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPN
IQSVLL
Ligand information
>6wz9 Chain J (length=148) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatcctgtg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wz9 Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R11 K15 T16 R17 R20 R29 R32 R77
Binding residue
(residue number reindexed from 1)		R1 K5 T6 R7 R10 R19 R22 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6wz9, PDBe:6wz9, PDBj:6wz9
PDBsum6wz9
PubMed32939087
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]