Structure of PDB 6vz4 Chain G Binding Site BS02

Receptor Information
>6vz4 Chain G (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
Ligand information
>6vz4 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcaggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vz4 Structural insights into assembly and function of the RSC chromatin remodeling complex.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R30 R43 V44 K76 T77 R78
Binding residue
(residue number reindexed from 1)		R18 R31 V32 K64 T65 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6vz4, PDBe:6vz4, PDBj:6vz4
PDBsum6vz4
PubMed33288924
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]