Structure of PDB 6pwx Chain G Binding Site BS02

Receptor Information
>6pwx Chain G (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6pwx Chain P (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pwx Cryo-EM structure of the human MLL1 core complex bound to the nucleosome.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		Y41 R42 R63 R72 R83 F84 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		Y5 R6 R27 R36 R47 F48 Q49 R80 V81 T82 M84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6pwx, PDBe:6pwx, PDBj:6pwx
PDBsum6pwx
PubMed31804488
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]