Structure of PDB 6pwf Chain G Binding Site BS02

Receptor Information

>6pwf Chain G (length=105) Species: 7227 (Drosophila melanogaster)

KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAV
LLPKK

Ligand information

>6pwf Chain J (length=146)

tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6pwf Structure of the primed state of the ATPase domain of chromatin remodeling factor ISWI bound to the nucleosome.
• Resolution: 4.07 Å
• Binding residue (original residue number in PDB): R16 G27 R76
• Binding residue (residue number reindexed from 1): R3 G14 R63

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0007526 larval somatic muscle development
• GO:0031507 heterochromatin formation

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005700 polytene chromosome
• GO:0005704 polytene chromosome band

External links

• PDB: RCSB:6pwf, PDBe:6pwf, PDBj:6pwf
• PDBsum: 6pwf
• PubMed: 31402386
• UniProt: P84051|H2A_DROME Histone H2A (Gene Name=His2A)