Structure of PDB 6n8n Chain G Binding Site BS02

Receptor Information
>6n8n Chain G (length=283) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFT
NKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIA
RRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTG
ARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQ
YMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPT
EKKFTKEQYAAESKKYRQTKLSKEERAARVAAK
Ligand information
>6n8n Chain B (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n8n Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		S10 S13 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R54 N57 K58 I61 Q63 I69 T70 D72 V74 H90 G91 N94 W95 Q151 R152 T155 A157 R158 Y198 H203 Y207 E210 R218 L222 K224 K258 K259 Q264 Y265 E268 S269 Y272 Q274 K276 L277 K279 R285 V286 K289
Binding residue
(residue number reindexed from 1)		S4 S7 T12 F14 R15 R16 R18 K21 T22 Y24 R27 R48 N51 K52 I55 Q57 I63 T64 D66 V68 H84 G85 N88 W89 Q145 R146 T149 A151 R152 Y192 H197 Y201 E204 R212 L216 K218 K252 K253 Q258 Y259 E262 S263 Y266 Q268 K270 L271 K273 R279 V280 K283
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8n, PDBe:6n8n, PDBj:6n8n
PDBsum6n8n
PubMed30814529
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]