Structure of PDB 6mtc Chain G Binding Site BS02

Receptor Information
>6mtc Chain G (length=233) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKV
PPAINQFTQVLDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAKRP
PVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCI
LKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEI
RRHWGGNVLGPKSVARIAKLEKAKAKELATKLG
Ligand information
>6mtc Chain 8 (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcagguugaucaucgacacuucgaac
gcacuugcggccccggguuccucccggggcuacgccugucugagcgucgc
u
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>........>>>..>...>>>....
<<<..>>><<<<<<<<.......>>>>>>>>...................
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mtc Structures of translationally inactive mammalian ribosomes.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		T105 Y113 I114 Q117 R118 R142 H212 D213 K238 R242
Binding residue
(residue number reindexed from 1)		T26 Y34 I35 Q38 R39 R63 H126 D127 K152 R156
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Apr 18 19:24:40 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6mtc', asym_id = 'G', bs = 'BS02', title = 'Structures of translationally inactive mammalian ribosomes.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6mtc', asym_id='G', bs='BS02', title='Structures of translationally inactive mammalian ribosomes.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0042254,1990904', uniprot = '', pdbid = '6mtc', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042254,1990904', uniprot='', pdbid='6mtc', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>