Structure of PDB 6lwo Chain G Binding Site BS02

Receptor Information
>6lwo Chain G (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEGPELHLASQFVNEACRVEKSSVSRNPEVPFESISASARGKELRLILSV
FRFGMSGSFQLVPREELPRHAHLRFYTAALCFVDIRRFGRWDLGGKWQPG
RGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEI
LYRLKIPPFEKARSVLEALPDLLELCHSVPKEVVQLDFAAFRAWLRCYMP
GMSSLQDRHGRTIWFQGDPGPLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lwo DNA repair glycosylase hNEIL1 triages damaged bases via competing interaction modes.
Resolution2.51 Å
Binding residue
(original residue number in PDB)
H96 I117 R118 R119 F120
Binding residue
(residue number reindexed from 1)
H70 I85 R86 R87 F88
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003684 damaged DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008270 zinc ion binding
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0019104 DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6lwo, PDBe:6lwo, PDBj:6lwo
PDBsum6lwo
PubMed34226550
UniProtQ96FI4|NEIL1_HUMAN Endonuclease 8-like 1 (Gene Name=NEIL1)

[Back to BioLiP]