Structure of PDB 6lwd Chain G Binding Site BS02

Receptor Information
>6lwd Chain G (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQGPELHLASQFVNEACVEKSSVSRNPEVPFISASARGKELRLILLVFRF
GMSGSFQLVPREELPRHAHLRFYTAPPGALCFVDIRRFGRWDLGGKWQPG
RGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEI
LYRLKIPPFEKARSVLEAPDLLELCHSVPKEVVQLGEEDFAAFRAWLRCY
GMPGMSSLQDRHGRTIWFQGDPGPLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lwd DNA repair glycosylase hNEIL1 triages damaged bases via competing interaction modes.
Resolution2.41 Å
Binding residue
(original residue number in PDB)
R95 H96 I117 R118 R119 F120
Binding residue
(residue number reindexed from 1)
R66 H67 I85 R86 R87 F88
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003684 damaged DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008270 zinc ion binding
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0019104 DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6lwd, PDBe:6lwd, PDBj:6lwd
PDBsum6lwd
PubMed34226550
UniProtQ96FI4|NEIL1_HUMAN Endonuclease 8-like 1 (Gene Name=NEIL1)

[Back to BioLiP]