Structure of PDB 6ltj Chain G Binding Site BS02

Receptor Information
>6ltj Chain G (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLP
Ligand information
>6ltj Chain Y (length=119) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tctgacacgtgcctggagactagggagtaatccccttggcggttaaaacg
cgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ltj Structure of nucleosome-bound human BAF complex.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R35 R42 V43 G44 A45 K75 R77
Binding residue
(residue number reindexed from 1)		R21 R28 V29 G30 A31 K61 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6ltj, PDBe:6ltj, PDBj:6ltj
PDBsum6ltj
PubMed32001526
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]