Structure of PDB 6jnn Chain G Binding Site BS02

Receptor Information
>6jnn Chain G (length=88) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRTE
HIRVHTGARPYVCAEPDCGQTFRFVSDFSRHKRKTGHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jnn DNA methylation repels targeting of Arabidopsis REF6.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
W1311 V1340 S1341 S1344
Binding residue
(residue number reindexed from 1)
W46 V75 S76 S79
Binding affinityPDBbind-CN: Kd=65.7nM
Enzymatic activity
Enzyme Commision number 1.14.11.-
External links
PDB RCSB:6jnn, PDBe:6jnn, PDBj:6jnn
PDBsum6jnn
PubMed31048693
UniProtQ9STM3|REF6_ARATH Lysine-specific demethylase REF6 (Gene Name=REF6)

[Back to BioLiP]