Structure of PDB 6gen Chain G Binding Site BS02

Receptor Information

>6gen Chain G (length=96) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASK
LAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSST

Ligand information

>6gen Chain J (length=173) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcacaggatgtatatatctgacacgtgcctggagactagggagtaatcc
ccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtg
ctagagctgtctacgaccaattgagcggcctcggcaccgggattctccag
ggcggccgcggatgcattaatgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6gen Structure and dynamics of the yeast SWR1-nucleosome complex.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	K34 R36 K37 T39 Y43
Binding residue (residue number reindexed from 1)	K2 R4 K5 T7 Y11

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006301	postreplication repair
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gen, PDBe:6gen, PDBj:6gen
PDBsum	6gen
PubMed	30309918
UniProt	P02293\|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]