Structure of PDB 6frk Chain G Binding Site BS02

Receptor Information
>6frk Chain G (length=238) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVVNLLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLK
VPPTINQFTQALDRQTATQLLKLTHKYRPETKQEKKQRLLARAEKKAAGK
GDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCR
KMGVPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTN
YNDRYNEIRRHWGGNVLGPKSVARITKLEKAKAKELAT
Ligand information
>6frk Chain 8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<.<<
.....>>>.......<<<......>>.............>>>......>>
>....<<<..>>><<<<<<<<.......>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6frk Structure of a prehandover mammalian ribosomal SRP·SRP receptor targeting complex.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
T52 Y60 I61 Q64 R65 R89 H159 D160 K185 R189
Binding residue
(residue number reindexed from 1)
T27 Y35 I36 Q39 R40 R64 H134 D135 K160 R164
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Nov 15 16:58:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6frk', asym_id = 'G', bs = 'BS02', title = 'Structure of a prehandover mammalian ribosomal SRP&#183;SRP receptor targeting complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6frk', asym_id='G', bs='BS02', title='Structure of a prehandover mammalian ribosomal SRP&#183;SRP receptor targeting complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0042254,1990904', uniprot = '', pdbid = '6frk', asym_id = 'G'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042254,1990904', uniprot='', pdbid='6frk', asym_id='G')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>