Structure of PDB 6fq6 Chain G Binding Site BS02

Receptor Information
>6fq6 Chain G (length=108) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP
NIQSVLLP
Ligand information
>6fq6 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fq6 Structural rearrangements of the histone octamer translocate DNA.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		A14 K15 T16 R17 R20 G28 R29 R32 R77
Binding residue
(residue number reindexed from 1)		A5 K6 T7 R8 R11 G19 R20 R23 R68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6fq6, PDBe:6fq6, PDBj:6fq6
PDBsum6fq6
PubMed29626188
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]