Structure of PDB 6dzt Chain G Binding Site BS02

Receptor Information

>6dzt Chain G (length=106) Species: 7227 (Drosophila melanogaster)

AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQA
VLLPKK

Ligand information

>6dzt Chain J (length=147)

atcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatccgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6dzt Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
• Resolution: 2.99 Å
• Binding residue (original residue number in PDB): K15 R17 R32 R77
• Binding residue (residue number reindexed from 1): K2 R4 R19 R64

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0007526 larval somatic muscle development
• GO:0031507 heterochromatin formation

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005700 polytene chromosome
• GO:0005704 polytene chromosome band

External links

• PDB: RCSB:6dzt, PDBe:6dzt, PDBj:6dzt
• PDBsum: 6dzt
• PubMed: 31127102
• UniProt: P84051|H2A_DROME Histone H2A (Gene Name=His2A)