Structure of PDB 6chv Chain G Binding Site BS02

Receptor Information
>6chv Chain G (length=91) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIR
IAAALGSTPEFWLRLQSNYDLRQLENQIDTSGIVLYGESNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6chv Structural basis of transcriptional regulation by the HigA antitoxin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		T34 A36 T37 R40 A47 T49 L52
Binding residue
(residue number reindexed from 1)		T29 A31 T32 R35 A42 T44 L47
Binding affinityPDBbind-CN: Kd=125nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0046982 protein heterodimerization activity
GO:0097351 toxin sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6chv, PDBe:6chv, PDBj:6chv
PDBsum6chv
PubMed30793388
UniProtQ7A224|HIGA_PROVU Antitoxin HigA (Gene Name=higA)

[Back to BioLiP]