Structure of PDB 5uyq Chain G Binding Site BS02

Receptor Information
>5uyq Chain G (length=151) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A
Ligand information
>5uyq Chain X (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uyq Ensemble cryo-EM elucidates the mechanism of translation fidelity
Resolution3.8 Å
Binding residue
(original residue number in PDB)		S76 T83 K135 R142 M143
Binding residue
(residue number reindexed from 1)		S76 T83 K135 R142 M143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uyq, PDBe:5uyq, PDBj:5uyq
PDBsum5uyq
PubMed28538735
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]