Structure of PDB 5umd Chain G Binding Site BS02

Receptor Information
>5umd Chain G (length=124) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRKISCFV
TVRGKKALEILEKGLKRRKNFSDTGNFGFGIGMDFYVHLSRSGYRVTRRT
RRRSKISKTHKVTKEDAMKWFQTK
Ligand information
>5umd Chain B (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacucguucauacuacaguggauacaccagaucccaucagaacucugaag
uuaagcacuguaaggcuuggcuaguacugaggugggagaccgcucgggaa
caccaggugaugagucag
<<<<<<<<....<<<<<<<<.....<<<<<<............>>>>..>
>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>...
..>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		M9 Q43 K44 I46 T70 R72 G135 R137 V138 R141 T142 R144 S146 S149 K150 T151 H152
Binding residue
(residue number reindexed from 1)		M2 Q36 K37 I39 T51 R53 G93 R95 V96 R99 T100 R102 S104 S107 K108 T109 H110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5umd, PDBe:5umd, PDBj:5umd
PDBsum5umd
PubMed28288098
UniProtQ8IBQ6

[Back to BioLiP]