Structure of PDB 5o6g Chain G Binding Site BS02

Receptor Information
>5o6g Chain G (length=178) Species: 2275 (Desulfurococcus mucosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHFAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMQERIRLFNMR
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o6g Structure and dynamics of mesophilic variants from the homing endonuclease I-DmoI.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		G20 D21 G22 Y25 Y29 K30 R33 R37 T41 K43 T76 R77 E117 R124 T150 H152 D154 R157 S166 L167 R168
Binding residue
(residue number reindexed from 1)		G16 D17 G18 Y21 Y25 K26 R29 R33 T37 K39 T72 R73 E113 R120 T146 H148 D150 R153 S162 L163 R164
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5o6g, PDBe:5o6g, PDBj:5o6g
PDBsum5o6g
PubMed29177929
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]