Structure of PDB 5n9g Chain G Binding Site BS02

Receptor Information
>5n9g Chain G (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIRE
PRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQ
NMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFV
SGKVVLTGAKVRAEIYEAFENIYPILKG
Ligand information
>5n9g Chain J (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttgaagggcttaaaataggtgtgac
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n9g Molecular mechanisms of Bdp1 in TFIIIB assembly and RNA polymerase III transcription initiation.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		V169 T171 F214 S216 K218 V220 Q256 N257 F288 R294 V301 L303 T313
Binding residue
(residue number reindexed from 1)		V13 T15 F58 S60 K62 V64 Q100 N101 F132 R138 V145 L147 T157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5n9g, PDBe:5n9g, PDBj:5n9g
PDBsum5n9g
PubMed28743884
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]