Structure of PDB 5n74 Chain G Binding Site BS02

Receptor Information
>5n74 Chain G (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIV
DILYA
Ligand information
>5n74 Chain P (length=11) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRLRPPTPLSQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n74 Short Linear Sequence Motif LxxPTPh Targets Diverse Proteins to Growing Microtubule Ends.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R214 F218 R222 E225 Y247
Binding residue
(residue number reindexed from 1)		R21 F25 R29 E32 Y54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008017 microtubule binding

View graph for
Molecular Function
External links
PDB RCSB:5n74, PDBe:5n74, PDBj:5n74
PDBsum5n74
PubMed28552577
UniProtH0XPX6

[Back to BioLiP]