Structure of PDB 5lj3 Chain G Binding Site BS02

Receptor Information
>5lj3 Chain G (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSRNVDKANSVLVRFQEQQAESAGGYKDYSRYQRPRNVSKVKSIKEANEW
KRQVSKEIKQKSTRIYDPSLNEMQIAELNDELNNLFKEWKRWQWHID
Ligand information
>5lj3 Chain Z (length=171) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuguaa
caacugaaaugaccuaggcucauuguuacaauacacauuuuuuggggacg
ggaagaggagacgucgcgacccucgcagagucguucuugacuuggucgcu
ugauguuucuucuucccguuc
.............................................<<<<<
<<<......<<<<<<>>>.>>>>>>>>>>>...............<<<<<
<<<<<<.<<<<<<<<<<<<.<<.....<<<<<<....>>>>>>>>>>>>.
.>>>>>>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lj3 Cryo-EM structure of the spliceosome immediately after branching.
Resolution3.8 Å
Binding residue
(original residue number in PDB)
M1 S10 V11 R14
Binding residue
(residue number reindexed from 1)
M1 S10 V11 R14
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000389 mRNA 3'-splice site recognition
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex
GO:0071020 post-spliceosomal complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5lj3, PDBe:5lj3, PDBj:5lj3
PDBsum5lj3
PubMed27459055
UniProtP21374|ISY1_YEAST Pre-mRNA-splicing factor ISY1 (Gene Name=ISY1)

[Back to BioLiP]