Structure of PDB 5li0 Chain G Binding Site BS02

Receptor Information
>5li0 Chain G (length=166) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAV
EELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLI
SVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDI
VIVTTANTDEEARELL
Ligand information
>5li0 Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc
.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><....<<...<.<............>.>....>>
...>..>..>.>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		M26 E27 I60 T61 Q63 G86 K88
Binding residue
(residue number reindexed from 1)		M22 E23 I56 T57 Q59 G82 K84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5li0, PDBe:5li0, PDBj:5li0
PDBsum5li0
PubMed27906650
UniProtQ2FW18|RL5_STAA8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]