Structure of PDB 5jvt Chain G Binding Site BS02

Receptor Information
>5jvt Chain G (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKP
NMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jvt Structures of mithramycin analogues bound to DNA and implications for targeting transcription factor FLI1.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q282 L283 W321 K325 K327 M330 K334 Y341 Y342
Binding residue
(residue number reindexed from 1)		Q4 L5 W43 K47 K49 M52 K56 Y63 Y64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5jvt, PDBe:5jvt, PDBj:5jvt
PDBsum5jvt
PubMed27587584
UniProtQ01543|FLI1_HUMAN Friend leukemia integration 1 transcription factor (Gene Name=FLI1)

[Back to BioLiP]