Structure of PDB 5gap Chain G Binding Site BS02

Receptor Information
>5gap Chain G (length=318) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLDLSKFKIYYDNNHGYEWWDTAYLDEKGELMEKYDMNGTSPAEEKLAED
IDEVDDDDDDEHPSIRYVAHPLPEKINEAKVSIKAYLTQHERKRLRRNRR
KMAREAREIKIKLGLLPKPEPKVKLSNMMSVFENDQNITDPTAWEKVVKD
QVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKPTVYHCKVFQFKNLQN
PKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKR
IKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQD
SLLRTLGQFDSEHFYSPV
Ligand information
>5gap Chain W (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuuggucaauuugaauacagagaucagcaguuccccugcauaaggauga
accguu
.........<<<..>>>.................................
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gap Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K242 R253 N276 S279 N312 H316 A319 R323 P350 K351 R353 F354 K355 K357 M358 R371 F391 R399 F441 M442 K443
Binding residue
(residue number reindexed from 1)		K93 R104 N127 S130 N163 H167 A170 R174 P201 K202 R204 F205 K206 K208 M209 R222 F242 R250 F292 M293 K294
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gap, PDBe:5gap, PDBj:5gap
PDBsum5gap
PubMed26829225
UniProtQ03338|PRP3_YEAST U4/U6 small nuclear ribonucleoprotein PRP3 (Gene Name=PRP3)

[Back to BioLiP]