Structure of PDB 5c8e Chain G Binding Site BS02

Receptor Information

>5c8e Chain G (length=280) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HMTSSGVYTIAEVEAMTGLSAEVLRQWERRYGFPKPRRTPGGHRLYSAED
VEALKTIKRWLEEGATPKAAIRRYLAQEVRPEDLGTGLLEALLRGDLAGA
EALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLR
ARLQELLDLAGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLG
PDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALKDLAPRVFLGGQ
GAGPEEARRLGAEYMEDLKGLAEALWLPRG

Ligand information

>5c8e Chain L (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgtacaaaagcttgacaaaacctat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5c8e Structural basis for gene regulation by a B12-dependent photoreceptor.
Resolution	3.89 Å
Binding residue (original residue number in PDB)	I9 R24 H42 R43
Binding residue (residue number reindexed from 1)	I10 R25 H43 R44

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0031419	cobalamin binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5c8e, PDBe:5c8e, PDBj:5c8e
PDBsum	5c8e
PubMed	26416754
UniProt	Q746J7

[Back to BioLiP]