Structure of PDB 5bn6 Chain G Binding Site BS02

Receptor Information
>5bn6 Chain G (length=133) Species: 3489 (Artocarpus heterophyllus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVIYDLNGSPFVGQNHTSFITG
FTPVKISLDFPSEYIIEVSGHTGKVSGYVVVRSLAFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>5bn6 Chain C (length=17) Species: 3489 (Artocarpus heterophyllus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QSGKSQTVIVGPWGAQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bn6 Crystal Structure of Frutalin from Artocarpus incisa in complex with galactose
Resolution1.6499 Å
Binding residue
(original residue number in PDB)		T96 V103 F128 D149 Y150 F151 S152 M153 Y154 L155
Binding residue
(residue number reindexed from 1)		T72 V79 F104 D125 Y126 F127 S128 M129 Y130 L131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding

View graph for
Molecular Function
External links
PDB RCSB:5bn6, PDBe:5bn6, PDBj:5bn6
PDBsum5bn6
PubMed
UniProtQ38720

[Back to BioLiP]