Structure of PDB 4uuv Chain G Binding Site BS02

Receptor Information

>4uuv Chain G (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPA
MNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPDALFSMAFPD

Ligand information

>4uuv Chain I (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acttccggtc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4uuv Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Q342 L343 W381 K385 K394 S398 Y401 Y402
Binding residue (residue number reindexed from 1)	Q3 L4 W42 K46 K55 S59 Y62 Y63

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4uuv, PDBe:4uuv, PDBj:4uuv
PDBsum	4uuv
PubMed	25866208
UniProt	P43268\|ETV4_HUMAN ETS translocation variant 4 (Gene Name=ETV4)

[Back to BioLiP]