Structure of PDB 4ru2 Chain G Binding Site BS02

Receptor Information
>4ru2 Chain G (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKY
SAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDS
MTATQLLVPSRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ru2 Crystal structure of a RNA-binding protein 39 (RBM39) in complex with fragment of splicing factor (U2AF) from Mus musculus at 2.20 A resolution
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y468 S469
Binding residue
(residue number reindexed from 1)		Y50 S51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ru2, PDBe:4ru2, PDBj:4ru2
PDBsum4ru2
PubMed
UniProtQ8VH51|RBM39_MOUSE RNA-binding protein 39 (Gene Name=Rbm39)

[Back to BioLiP]