Structure of PDB 4r8p Chain G Binding Site BS02

Receptor Information
>4r8p Chain G (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
Ligand information
>4r8p Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r8p Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
Resolution3.2846 Å
Binding residue
(original residue number in PDB)		A14 K15 R17 R20 R29 R32 R42
Binding residue
(residue number reindexed from 1)		A3 K4 R6 R9 R18 R21 R31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4r8p, PDBe:4r8p, PDBj:4r8p
PDBsum4r8p
PubMed25355358
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]