Structure of PDB 4qpq Chain G Binding Site BS02

Receptor Information
>4qpq Chain G (length=50) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qpq Mechanistic Basis of Plasmid-Specific DNA Binding of the F Plasmid Regulatory Protein, TraM.
Resolution3.106 Å
Binding residue
(original residue number in PDB)		K3 N5 Y7
Binding residue
(residue number reindexed from 1)		K2 N4 Y6
Binding affinityPDBbind-CN: Kd=0.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4qpq, PDBe:4qpq, PDBj:4qpq
PDBsum4qpq
PubMed25284757
UniProtP10026|TRAM1_ECOLI Relaxosome protein TraM (Gene Name=traM)

[Back to BioLiP]