Structure of PDB 4qlc Chain G Binding Site BS02

Receptor Information

>4qlc Chain G (length=104) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQA
VLLP

Ligand information

>4qlc Chain J (length=166) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acttacatgcacaggatgtatatatctgacacgtgcctggagactaggga
gtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tctccagggcggccag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
Resolution	3.503 Å
Binding residue (original residue number in PDB)	A13 R16 R28 R31 R41 R76
Binding residue (residue number reindexed from 1)	A1 R4 R16 R19 R29 R64
Binding affinity	PDBbind-CN: Kd=0.35uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006334	nucleosome assembly
GO:0007526	larval somatic muscle development
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005700	polytene chromosome
GO:0005704	polytene chromosome band

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum	4qlc
PubMed	26212454
UniProt	P84051\|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]