Structure of PDB 4d6o Chain G Binding Site BS02

Receptor Information
>4d6o Chain G (length=176) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLM
QFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMREQ
IAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDH
RHGVYVLNISLRDRIKFVHTILSSHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4d6o Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		G20 D21 G22 Y25 Y29 R33 R37 T41 Q42 K43 T76 R77 R124 T150 H152 D154 R157 N164 S166 L167
Binding residue
(residue number reindexed from 1)		G14 D15 G16 Y19 Y23 R27 R31 T35 Q36 K37 T70 R71 R118 T144 H146 D148 R151 N158 S160 L161
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4d6o, PDBe:4d6o, PDBj:4d6o
PDBsum4d6o
PubMed25486305
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]