Structure of PDB 4bqa Chain G Binding Site BS02

Receptor Information
>4bqa Chain G (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKP
KMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bqa Structural Insights Into the Autoregulation and Cooperativity of the Human Transcription Factor Ets-2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q364 W403 K407 M412 Y423 Y424
Binding residue
(residue number reindexed from 1)		Q4 W43 K47 M52 Y63 Y64
Binding affinityPDBbind-CN: Kd=0.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4bqa, PDBe:4bqa, PDBj:4bqa
PDBsum4bqa
PubMed25670864
UniProtP15036|ETS2_HUMAN Protein C-ets-2 (Gene Name=ETS2)

[Back to BioLiP]