Structure of PDB 3zqc Chain G Binding Site BS02

Receptor Information
>3zqc Chain G (length=118) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKGPFTEAEDDLIREYVKENGPQNWPRITSFLPNRSPKQCRERWFNHLDP
AVVKHAWTPEEDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSIS
KRISTNSNHKEILLPDRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zqc Structure of the Trichomonas Vaginalis Myb3 DNA-Binding Domain Bound to a Promoter Sequence Reveals a Unique C-Terminal Beta-Hairpin Conformation.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K53 Q74 R92 F96 S125 W127 S128
Binding residue
(residue number reindexed from 1)		K2 Q23 R41 F45 S74 W76 S77
Enzymatic activity
Enzyme Commision number ?
External links