Structure of PDB 3waa Chain G Binding Site BS02

Receptor Information
>3waa Chain G (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVL
ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKS
LIGK
Ligand information
>3waa Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3waa Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V17 S18 R31 H43 R45 R80
Binding residue
(residue number reindexed from 1)		V1 S2 R15 H27 R29 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
GO:0060090 molecular adaptor activity
Biological Process
GO:0006325 chromatin organization
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3waa, PDBe:3waa, PDBj:3waa
PDBsum3waa
PubMed24311584
UniProtQ71UI9|H2AV_HUMAN Histone H2A.V (Gene Name=H2AZ2)

[Back to BioLiP]