Structure of PDB 3nic Chain G Binding Site BS02

Receptor Information

>3nic Chain G (length=209) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HNKKFDRSEHVYRNDSFLELIKDAVRFFSGTPVHSLPPPERFQGAGVFAL
YYTGHYSLYDEYSRINRKAYNLPIYVGKAVPAGWRQSRISDHETRAGSEL
SNRIREHGRNIAKTSNLDLCDFSCRFVIFEATGSDMISTVEAALIKIYKP
LWNTVVDGFGNHTPGAGRFAQAKSDWDVIHPGREWAEKCTGVHSEPYFIE
ERIKQYFSK

Ligand information

>3nic Chain J (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcggcggcccgcgggcctcccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3nic Folding, DNA Recognition, and Function of GIY-YIG Endonucleases: Crystal Structures of R.Eco29kI.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	T164 P165 A167 R169
Binding residue (residue number reindexed from 1)	T163 P164 A166 R168

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0042802	identical protein binding

View graph for
Molecular Function

External links

PDB	RCSB:3nic, PDBe:3nic, PDBj:3nic
PDBsum	3nic
PubMed	20800503
UniProt	Q46944

[Back to BioLiP]