Structure of PDB 3eh8 Chain G Binding Site BS02

Receptor Information
>3eh8 Chain G (length=254) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDLTYAYLVGLYEGDGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKI
LGIGIVSFRKRNEIEMVALRIRDKNHLKSKILPIFEKYPMFSNKQYDYLR
FRNALLSGIIYLEDLPDYTRSDEPLNSIESIINTSYFSAWLVGFIEAEGC
FSVYKLNKDDDYLIASFDIAQRDGDILISAIRKYLSFTTKVYLDKTNCSK
LKVTSVRSVENIIKFLQNAPVKLLGNKKLQYKLWLKQLRKISRYSEKIKI
PSNY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3eh8 Optimization of in vivo activity of a bifunctional homing endonuclease and maturase reverses evolutionary degradation.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		G15 D16 G17 Y18 S20 T22 K23 K24 E35 L36 S37 I64 M66 K94 Y162 K190 Y192 V206 R243
Binding residue
(residue number reindexed from 1)		G15 D16 G17 Y18 S20 T22 K23 K24 E35 L36 S37 I64 M66 K94 Y162 K190 Y192 V206 R243
Binding affinityPDBbind-CN: Kd=12nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:3eh8, PDBe:3eh8, PDBj:3eh8
PDBsum3eh8
PubMed19103658
UniProtP03880|ANI1_EMEND Intron-encoded DNA endonuclease I-AniI (Gene Name=I-AniI)

[Back to BioLiP]