Structure of PDB 3c1c Chain G Binding Site BS02

Receptor Information
>3c1c Chain G (length=104) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILEL
AGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVL
LPKK
Ligand information
>3c1c Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c1c The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		R1017 R1020 R1029 R1032 R1042 R1077
Binding residue
(residue number reindexed from 1)		R2 R5 R14 R17 R27 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3c1c, PDBe:3c1c, PDBj:3c1c
PDBsum3c1c
PubMed18794842
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]