Structure of PDB 3ax3 Chain G Binding Site BS02

Receptor Information
>3ax3 Chain G (length=68) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQ
VLQQTLPPPVFQMLLTKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ax3 Crystallographic snapshots of tom20-mitochondrial presequence interactions with disulfide-stabilized peptides.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		I74 E78
Binding residue
(residue number reindexed from 1)		I16 E20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ax3, PDBe:3ax3, PDBj:3ax3
PDBsum3ax3
PubMed21591667
UniProtQ62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)

[Back to BioLiP]