Structure of PDB 3an2 Chain G Binding Site BS02

Receptor Information

>3an2 Chain G (length=100) Species: 9606 (Homo sapiens)

KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAV

Ligand information

>3an2 Chain J (length=121)

aacgggatttcttcatttcatgctagacagaagaattctcagtaacttct
ttgtgctggtaaccagcacaaagaagttactgagaattcttctgtctagc
atgaaatgaagaaatcccgtt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3an2 Crystal structure of the human centromeric nucleosome containing CENP-A
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): K15 R17 R20 G28 R77
• Binding residue (residue number reindexed from 1): K1 R3 R6 G14 R63

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0008285 negative regulation of cell population proliferation
• GO:0031507 heterochromatin formation
• GO:0061644 protein localization to CENP-A containing chromatin

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0043505 CENP-A containing nucleosome
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3an2, PDBe:3an2, PDBj:3an2
• PDBsum: 3an2
• PubMed: 21743476
• UniProt: P04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)