Structure of PDB 2p5l Chain G Binding Site BS02

Receptor Information
>2p5l Chain G (length=63) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLV
KVPTNNGSYKYSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2p5l Structure and function of the arginine repressor-operator complex from Bacillus subtilis.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		T21 Q22 Q38 S42 R43 K52 Y62
Binding residue
(residue number reindexed from 1)		T20 Q21 Q37 S41 R42 K51 Y61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006525 arginine metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2p5l, PDBe:2p5l, PDBj:2p5l
PDBsum2p5l
PubMed18455186
UniProtP17893|ARGR_BACSU Arginine repressor (Gene Name=argR)

[Back to BioLiP]